15

Recombinant Human papillomavirus type 16 Protein E6(E6)

Details

Recombinant Human papillomavirus type 16 Protein E6(E6)

Name

RPC20140

Catalog Number

1599 EUR

Price

1 mg

Size

More information

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Protein sequence

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Notes

For research use only. Not for diagnostic procedures.

Source

Recombinants or rec. proteins

Verified reactivity

Homo sapiens (Human)

Other name

no alternative name

Estimated production time

7-11 business days

Group

recombinants

Information about sequence

Full Length

Shipping requirements

Blue ice

Expected molecular weight

23.3kDa

Protein region

1-158aa

Protein purity

≥ 90%

Protein number

P03126

Use before

1 year

Protein origin

E.coli

Gene number

E6

Back to top