15

HPV16 protein

Details

HPV16 protein

Name

30R-3327

Catalog Number

327 EUR

Price

100 µg

Size

More information

Residues

Amino Acid Sequence: MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTN IYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSF YNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECIS MDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFG AMDFTTLQANKSEVPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRA GTVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNG ICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCK ITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRFVTQAIACQKHTPPAPKED DPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTST TAKRKKRKL.

Storage

Stable at 4 deg C for 1 week, Store below -18 deg C for long term storage. Avoid freeze thaw cycles.

Form & Buffer

Provided as a clear liquid with 1xPBS, 40 mM arginine and 0.02% NaN3

Method of Purification

HPV16 protein was purified by GSH affinity chromatography technique

Antibody Subtype

Recombinant Proteins

Grade & Purity

Grater than 95% pure

Area of research

Infectious Disease

Expression System

Escherichia coli

Type of protein

Recombinant

Category

Proteins

Shipping conditions

Blue Ice

Reactivity

Human

Back to top