15

HPV16 protein

Details

HPV16 protein

Name

30R-3327

Catalog Number

375 EUR

Price

100 ug

Size

More information

Tag/Conjugate

Amino Acid Sequence: MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTN IYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSF YNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECIS MDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFG AMDFTTLQANKSEVPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRA GTVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNG ICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCK ITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRFVTQAIACQKHTPPAPKED DPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTST TAKRKKRKL.

Form & Buffer

Supplied as a clear liquid with 1xPBS, 40mM arginine and 0.02% sodium azide. Please Note: Buffer may change with new Lots.

Storage

Stable at 4 deg C for 1 week, Store below -18 deg C for long term storage. Avoid freeze thaw cycles.

Product Subtype

Recombinant Proteins

Research Area

Infectious Disease

Type1

Recombinant

Product Type

Proteins

Shipping Info

Blue Ice

Applications

NA

Back to top